Anti-Caspase 8 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-Caspase 8 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10010
• Supplier Catalog Number: ABO10010
• Alternative Catalog Number: ABT-ABO10010-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: WB, IHC-P
• Species Reactivity: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids.
• Alternative Names: Caspase-8, CASP-8, 3.4.22.61, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, FLICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, MACH, Caspase-8 subunit p18, Caspase-

Product Description

Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 55391
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images