A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Alternative Names:
High mobility group protein B1, High mobility group protein 1, HMG-1, HMGB1, HMG1
Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality:
Polyclonal
Concentration:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight:
24894
Antibody Type:
Polyclonal Antibody
Application Notes:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted