Anti-HMGB1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10014
- Images (4)
| Article Name: | Anti-HMGB1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: | ABT-ABO10014 |
| Supplier Catalog Number: | ABO10014 |
| Alternative Catalog Number: | ABT-ABO10014-100UG |
| Manufacturer: | Abcepta |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB, IHC-P |
| Species Reactivity: | Human, Rat, Mouse |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences. |
| Alternative Names: | High mobility group protein B1, High mobility group protein 1, HMG-1, HMGB1, HMG1 |
| Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
| Clonality: | Polyclonal |
| Concentration: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Molecular Weight: | 24894 |
| Antibody Type: | Polyclonal Antibody |
| Application Notes: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|
|
|
|
|
|
|
|
|
|
|
Product Guarantee and Expert Support
