A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Alternative Names:
Apoptosis regulator BAX, Bcl-2-like protein 4, Bcl2-L-4, BAX, BCL2L4
Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality:
Polyclonal
Concentration:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight:
21184
Antibody Type:
Polyclonal Antibody
Application Notes:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted