Anti-Bax Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10036
- Images (4)
| Article Name: | Anti-Bax Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: | ABT-ABO10036 |
| Supplier Catalog Number: | ABO10036 |
| Alternative Catalog Number: | ABT-ABO10036-100UG |
| Manufacturer: | Abcepta |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB, IHC-P |
| Species Reactivity: | Human, Rat, Mouse |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. |
| Alternative Names: | Apoptosis regulator BAX, Bcl-2-like protein 4, Bcl2-L-4, BAX, BCL2L4 |
| Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
| Clonality: | Polyclonal |
| Concentration: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Molecular Weight: | 21184 |
| Antibody Type: | Polyclonal Antibody |
| Application Notes: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|
|
|
|
|
|
|
|
|
|
|
Product Guarantee and Expert Support
