Anti-ATP7b Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10101
- Images (4)
| Article Name: | Anti-ATP7b Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: | ABT-ABO10101 |
| Supplier Catalog Number: | ABO10101 |
| Alternative Catalog Number: | ABT-ABO10101-100UG |
| Manufacturer: | Abcepta |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB, IHC-P |
| Species Reactivity: | Human, Rat, Mouse |
| Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids. |
| Alternative Names: | Copper-transporting ATPase 2, 3.6.3.54, Copper pump 2, Wilson disease-associated protein, WND/140 kDa, ATP7B, PWD, WC1, WND |
| Rabbit IgG polyclonal antibody for Copper-transporting ATPase 2(ATP7B) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
| Clonality: | Polyclonal |
| Concentration: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Molecular Weight: | 157263 |
| Antibody Type: | Polyclonal Antibody |
| Application Notes: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|
|
|
|
|
|
|
|
|
|
|
Product Guarantee and Expert Support
