Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal

Catalog Number: ANI-73-399
Article Name: Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ANI-73-399
Supplier Catalog Number: 73-399
Alternative Catalog Number: ANI-73-399
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ELISA, ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Conjugation: Unconjugated
Alternative Names: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Our Anti-SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323B/20. It detects human, mouse, and rat SUR2B, and is TC supernatant. It is great for use in IHC, ICC, WB.
Clonality: Monoclonal
Concentration: Lot dependent
Clone Designation: [N323B/20]
Molecular Weight: 175 kDa (and smaller fragments likely due to proteolytic cleavage)
Isotype: IgG2b
UniProt: Q63563
Buffer: Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
Target: SUR2B
Antibody Type: Primary Antibody