Anti-Ataxin-1, 11NQ Antibody, IgG2b, Clone: [N76/8], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-Ataxin-1, 11NQ Antibody, IgG2b, Clone: [N76/8], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-117
• Supplier Catalog Number: 75-117
• Alternative Catalog Number: ANI-75-117
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ELISA, ICC, IHC, IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
• Conjugation: Unconjugated
• Alternative Names: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Product Description

Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.

Product Properties

• Clonality: Monoclonal
• Concentration: 1 mg/mL
• Clone Designation: [N76/8]
• Molecular Weight: 85 kDa
• Isotype: IgG2b
• UniProt: P54254
• Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.45
• Target: Ataxin-1, 11NQ
• Antibody Type: Primary Antibody