Anti-SUR2A Antibody (BSA and Azide free), IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-SUR2A Antibody (BSA and Azide free), IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-296-CF
• Supplier Catalog Number: 75-296-CF
• Alternative Catalog Number: ANI-75-296-CF
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ELISA, ICC, IHC, WB
• Species Reactivity: Mouse, Rat
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Product Description

Our carrier-free Anti-SUR2A mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N319A/14. It is KO validated, detects mouse and rat SUR2A, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Product Properties

• Clonality: Monoclonal
• Concentration: 1 mg/mL
• Clone Designation: [N319A/14]
• Molecular Weight: 120 kDa
• Isotype: IgG2a
• UniProt: P70170
• Buffer: PBS
• Target: SUR2A
• Antibody Type: Primary Antibody