Anti-REEP1 Antibody FL550 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal

Catalog Number: ANI-75-313-FL550
Article Name: Anti-REEP1 Antibody FL550 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-313-FL550
Supplier Catalog Number: 75-313-FL550
Alternative Catalog Number: ANI-75-313-FL550
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Mouse, Rat
Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Conjugation: FL550
Alternative Names: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Our Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N345/51]
Molecular Weight: 22 kDa
Isotype: IgG2b
UniProt: Q8BGH4
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Purified by Protein A chromatography
Target: REEP1
Antibody Type: Primary Antibody