Anti-Kv1.2 Potassium Channel Subunit Antibody FL550 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal

Catalog Number: ANI-75-314-FL550
Article Name: Anti-Kv1.2 Potassium Channel Subunit Antibody FL550 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-314-FL550
Supplier Catalog Number: 75-314-FL550
Alternative Catalog Number: ANI-75-314-FL550
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
Conjugation: FL550
Alternative Names: Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
Our Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC.
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [L76/36]
Molecular Weight: 80 kDa
Isotype: IgG2a
UniProt: P16389
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Purified by Protein A chromatography
Target: Kv1.2 potassium channel subunit
Antibody Type: Primary Antibody