Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
Conjugation:
Unconjugated
Alternative Names:
Synaptic vesicle 2-related protein (SV2-related protein)
Our carrier-free Anti-SVOP mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by Protein A chromatography. It is great for use in ICC, WB.