Anti-Kir6.2 Potassium Channel Antibody FL650 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal

Product Overview

• Article Name: Anti-Kir6.2 Potassium Channel Antibody FL650 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-393-FL650
• Supplier Catalog Number: 75-393-FL650
• Alternative Catalog Number: ANI-75-393-FL650
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Mouse, Rat
• Immunogen: Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
• Conjugation: FL650
• Alternative Names: ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)

Product Description

Our Anti-Kir6.2 potassium channel mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N363/71. It detects mouse and rat Kir6.2 potassium channel, and is purified by Protein A chromatography. It is great for use in IHC, ICC.

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [N363/71]
• Molecular Weight: 45 kDa
• Isotype: IgG1
• UniProt: P70673
• Buffer: PBS with 0.09% azide
• Target: Kir6.2 potassium channel
• Antibody Type: Primary Antibody