Anti-FCGRT
Catalog Number:
ATA-AMAB91199
- Images (7)
| Article Name: | Anti-FCGRT |
| Biozol Catalog Number: | ATA-AMAB91199 |
| Supplier Catalog Number: | AMAb91199 |
| Alternative Catalog Number: | ATA-AMAB91199-100,ATA-AMAB91199-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | alpha-chain, FCRN |
| Fc fragment of IgG, receptor, transporter, alpha |
| Anti-FCGRT |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL3638] |
| Isotype: | IgG2a |
| NCBI: | 2217 |
| UniProt: | P55899 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FCGRT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells. |
|
|
Immunohistochemical staining of human lymph node shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows immunoreactivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control). |
|
|
AMAb91199-100ul |
|
|
AMAb91199-100ul |
|
|
AMAb91199-100ul |
Product Guarantee and Expert Support
