Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG
Target:
RACGAP1
WB Suggested Anti-RACGAP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, RACGAP1 is supported by BioGPS gene expression data to be expressed in ACHN.
* VAT and and shipping costs not included. Errors and price changes excepted
