CUX1 Antibody : FITC (ARP30989_P050-FITC), Rabbit, Polyclonal
Catalog Number:
ASB-ARP30989_P050-FITC
- Images (0)
| Article Name: | CUX1 Antibody : FITC (ARP30989_P050-FITC), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP30989_P050-FITC |
| Supplier Catalog Number: | ARP30989_P050-FITC |
| Alternative Catalog Number: | ASB-ARP30989_P050-FITC-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF |
| Conjugation: | FITC |
| Alternative Names: | CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317 |
