CUX1 Antibody : HRP (ARP30989_P050-HRP), Rabbit, Polyclonal

Product Overview

• Article Name: CUX1 Antibody : HRP (ARP30989_P050-HRP), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP30989_P050-HRP
• Supplier Catalog Number: ARP30989_P050-HRP
• Alternative Catalog Number: ASB-ARP30989_P050-HRP-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
• Conjugation: HRP
• Alternative Names: CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 164 kDa
• NCBI: 1523
• UniProt: P39880
• Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.