CUX1 Antibody : HRP (ARP30989_P050-HRP), Rabbit, Polyclonal

Catalog Number: ASB-ARP30989_P050-HRP
Article Name: CUX1 Antibody : HRP (ARP30989_P050-HRP), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP30989_P050-HRP
Supplier Catalog Number: ARP30989_P050-HRP
Alternative Catalog Number: ASB-ARP30989_P050-HRP-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Species Reactivity: Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
Conjugation: HRP
Alternative Names: CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 164 kDa
NCBI: 1523
UniProt: P39880
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.