RBL1 Antibody : FITC (ARP31025_P050-FITC), Rabbit, Polyclonal

Product Overview

• Article Name: RBL1 Antibody : FITC (ARP31025_P050-FITC), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP31025_P050-FITC
• Supplier Catalog Number: ARP31025_P050-FITC
• Alternative Catalog Number: ASB-ARP31025_P050-FITC-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
• Conjugation: FITC
• Alternative Names: PRB1, p107, CP107

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 121 kDa
• NCBI: 5933
• UniProt: P28749
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.