MYBBP1A Antibody : Biotin (ARP39098_P050-Biotin), Rabbit, Polyclonal
Catalog Number:
ASB-ARP39098_P050-BIOTIN
- Images (0)
| Article Name: | MYBBP1A Antibody : Biotin (ARP39098_P050-Biotin), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP39098_P050-BIOTIN |
| Supplier Catalog Number: | ARP39098_P050-Biotin |
| Alternative Catalog Number: | ASB-ARP39098_P050-BIOTIN-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA |
| Conjugation: | Biotin |
| Alternative Names: | P160, PAP2, Pol5 |
