MYBBP1A Antibody : HRP (ARP39098_P050-HRP), Rabbit, Polyclonal

Product Overview

• Article Name: MYBBP1A Antibody : HRP (ARP39098_P050-HRP), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP39098_P050-HRP
• Supplier Catalog Number: ARP39098_P050-HRP
• Alternative Catalog Number: ASB-ARP39098_P050-HRP-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA
• Conjugation: HRP
• Alternative Names: P160, PAP2, Pol5

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 149 kDa
• NCBI: 10514
• UniProt: Q9BQG0
• Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.