CUX1 Antibody : FITC (ARP40035_P050-FITC), Rabbit, Polyclonal

Catalog Number: ASB-ARP40035_P050-FITC
Article Name: CUX1 Antibody : FITC (ARP40035_P050-FITC), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP40035_P050-FITC
Supplier Catalog Number: ARP40035_P050-FITC
Alternative Catalog Number: ASB-ARP40035_P050-FITC-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Species Reactivity: Bovine, Canine, Human, Porcine
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
Conjugation: FITC
Alternative Names: CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 164 kDa
NCBI: 1523
UniProt: P39880
Form: Liquid. Purified antibody supplied in 1x PBS buffer.