MAP3K13 Antibody : Biotin (ARP40550_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: MAP3K13 Antibody : Biotin (ARP40550_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP40550_P050-BIOTIN
• Supplier Catalog Number: ARP40550_P050-Biotin
• Alternative Catalog Number: ASB-ARP40550_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCISSCQS
• Conjugation: Biotin
• Alternative Names: LZK, MLK, MEKK13

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 108 kDa
• NCBI: 9175
• UniProt: O43283
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.