CGN Antibody : Biotin (ARP42912_P050-Biotin), Rabbit, Polyclonal

Catalog Number: ASB-ARP42912_P050-BIOTIN
Article Name: CGN Antibody : Biotin (ARP42912_P050-Biotin), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP42912_P050-BIOTIN
Supplier Catalog Number: ARP42912_P050-Biotin
Alternative Catalog Number: ASB-ARP42912_P050-BIOTIN-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLERKVKELSI
Conjugation: Biotin
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 136 kDa
NCBI: 57530
UniProt: Q9P2M7
Form: Liquid. Purified antibody supplied in 1x PBS buffer.