INADL Antibody : Biotin (ARP42940_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: INADL Antibody : Biotin (ARP42940_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP42940_P050-BIOTIN
• Supplier Catalog Number: ARP42940_P050-Biotin
• Alternative Catalog Number: ASB-ARP42940_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence DMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSA
• Conjugation: Biotin
• Alternative Names: Cipp, INADL, hINADL, InaD-like

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 196 kDa
• NCBI: 10207
• UniProt: Q8NI35
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.