SLC29A3 Antibody : Biotin (ARP43986_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: SLC29A3 Antibody : Biotin (ARP43986_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP43986_P050-BIOTIN
• Supplier Catalog Number: ARP43986_P050-Biotin
• Alternative Catalog Number: ASB-ARP43986_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Canine, Equine, Guinea pig, Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AWIQVPGPNSKALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPA
• Conjugation: Biotin
• Alternative Names: ENT3, HJCD, PHID, HCLAP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 52 kDa
• NCBI: 55315
• UniProt: Q9BZD2
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.