CHCHD4 Antibody : Biotin (ARP51896_P050-Biotin), Rabbit, Polyclonal
Catalog Number:
ASB-ARP51896_P050-BIOTIN
- Images (0)
| Article Name: | CHCHD4 Antibody : Biotin (ARP51896_P050-Biotin), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP51896_P050-BIOTIN |
| Supplier Catalog Number: | ARP51896_P050-Biotin |
| Alternative Catalog Number: | ASB-ARP51896_P050-BIOTIN-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence HYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAE |
| Conjugation: | Biotin |
| Alternative Names: | MIA40, TIMM40 |
