CHCHD4 Antibody : Biotin (ARP51896_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: CHCHD4 Antibody : Biotin (ARP51896_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP51896_P050-BIOTIN
• Supplier Catalog Number: ARP51896_P050-Biotin
• Alternative Catalog Number: ASB-ARP51896_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence HYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAE
• Conjugation: Biotin
• Alternative Names: MIA40, TIMM40

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 16 kDa
• NCBI: 131474
• UniProt: Q8N4Q1
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.