AURKC Antibody : Biotin (ARP53573_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: AURKC Antibody : Biotin (ARP53573_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP53573_P050-BIOTIN
• Supplier Catalog Number: ARP53573_P050-Biotin
• Alternative Catalog Number: ASB-ARP53573_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
• Conjugation: Biotin
• Alternative Names: AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 36 kDa
• NCBI: 6795
• UniProt: Q9UQB9
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.