GBA2 Antibody : Biotin (ARP57499_P050-Biotin), Rabbit, Polyclonal

Catalog Number: ASB-ARP57499_P050-BIOTIN
Article Name: GBA2 Antibody : Biotin (ARP57499_P050-Biotin), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP57499_P050-BIOTIN
Supplier Catalog Number: ARP57499_P050-Biotin
Alternative Catalog Number: ASB-ARP57499_P050-BIOTIN-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ
Conjugation: Biotin
Alternative Names: AD035, SPG46, NLGase
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 105 kDa
NCBI: 57704
UniProt: Q9HCG7
Form: Liquid. Purified antibody supplied in 1x PBS buffer.