UBA6 Antibody : Biotin (ARP59383_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: UBA6 Antibody : Biotin (ARP59383_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP59383_P050-BIOTIN
• Supplier Catalog Number: ARP59383_P050-Biotin
• Alternative Catalog Number: ASB-ARP59383_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL
• Conjugation: Biotin
• Alternative Names: E1-L2, MOP-4, UBE1L2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 118 kDa
• NCBI: 55236
• UniProt: A0AVT1
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.