LGALS7 Antibody

Product Overview

• Article Name: LGALS7 Antibody
• Biozol Catalog Number: ASB-ARP64142_P050
• Supplier Catalog Number: ARP64142_P050
• Alternative Catalog Number: ASB-ARP64142_P050-25UL,ASB-ARP64142_P050-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Proteine/Peptide
• Application: IHC
• Species Reactivity: Bovine, Canine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
• Alternative Names: GAL7, LGALS7A

Product Description

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 15 kDa
• NCBI: 3963
• UniProt: P47929
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images

Rabbit Anti-LGALS7 antibody
Catalog Number: ARP64142
Formalin Fixed Paraffin Embedded Tissue: Human Skin
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Rabbit Anti-LGALS7 antibody
Catalog Number: ARP64142
Formalin Fixed Paraffin Embedded Tissue: Human Thymus
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

LGALS7 Antibody (ARP64142_P050) in Human Skin using Immunohistochemistry