DUOXA2 Antibody

Product Overview

• Article Name: DUOXA2 Antibody
• Biozol Catalog Number: ASB-ARP64802_P050
• Supplier Catalog Number: ARP64802_P050
• Alternative Catalog Number: ASB-ARP64802_P050-25UL,ASB-ARP64802_P050-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Proteine/Peptide
• Application: IHC
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV
• Alternative Names: TDH5, SIMNIPHOM

Product Description

This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5.

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 35 kDa
• NCBI: 405753
• UniProt: Q1HG44
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images

Rabbit Anti-DUOXA2 antibody
Catalog Number: ARP64802
Formalin Fixed Paraffin Embedded Tissue: Human Adrenal
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Rabbit Anti-DUOXA2 antibody
Catalog Number: ARP64802
Formalin Fixed Paraffin Embedded Tissue: Human Colon
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

DUOXA2 Antibody (ARP64802_P050) in Human Adrenal using Immunohistochemistry