DCAF4 Recombinant Protein, Human

Catalog Number: ASB-OPCA02436
Article Name: DCAF4 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02436
Supplier Catalog Number: OPCA02436
Alternative Catalog Number: ASB-OPCA02436-100UG,ASB-OPCA02436-1MG,ASB-OPCA02436-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: DDB1- and CUL4-associated factor 4,WD repeat domain 21A,WD repeat-containing protein 21A,WDR21,WDR21A.
May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Molecular Weight: 71.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 26094
UniProt: Q8WV16
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGC