NFYA3 Recombinant Protein, A. thaliana

Catalog Number: ASB-OPCA02437
Article Name: NFYA3 Recombinant Protein, A. thaliana
Biozol Catalog Number: ASB-OPCA02437
Supplier Catalog Number: OPCA02437
Alternative Catalog Number: ASB-OPCA02437-100UG,ASB-OPCA02437-1MG,ASB-OPCA02437-20UG
Manufacturer: Aviva
Host: A. thaliana
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Alternative Names: AT1G72830,ATHAP2C,F3N23.3,F3N23_3,HAP2C,nuclear factor Y,nuclear factor Y,nuclear factor Y, subunit A3,subunit A3,subunit A3,Transcriptional activator HAP2C.
Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Molecular Weight: 41.6 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 843614
UniProt: Q93ZH2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQD