Pectate lyase 1 Recombinant Protein, Plant

Catalog Number: ASB-OPCA02438
Article Name: Pectate lyase 1 Recombinant Protein, Plant
Biozol Catalog Number: ASB-OPCA02438
Supplier Catalog Number: OPCA02438
Alternative Catalog Number: ASB-OPCA02438-100UG,ASB-OPCA02438-1MG,ASB-OPCA02438-20UG
Manufacturer: Aviva
Host: Plant
Category: Proteine/Peptide
Species Reactivity: Plant
Alternative Names: Major pollen allergen Cha o 1.
Has pectate lyase activity.
Concentration: Varies by lot. See vial for exact concentration.
Molecular Weight: 54.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q96385
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGG