Serpina3n Recombinant Protein

Catalog Number: ASB-OPCA03050
Article Name: Serpina3n Recombinant Protein
Biozol Catalog Number: ASB-OPCA03050
Supplier Catalog Number: OPCA03050
Alternative Catalog Number: ASB-OPCA03050-100UG, ASB-OPCA03050-1MG, ASB-OPCA03050-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: Spi2
The single human alpha1-antichymotrypsin gene (SERPINA3) is represented by cluster of 14 individual murine paralogs.
Concentration: Varies by lot. See vial for exact concentration.
Molecular Weight: 46.8 kDa
Tag: N-terminal 6xHis-tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFI