CCL20 Recombinant Protein, Bovine

Catalog Number: ASB-OPCA03052
Article Name: CCL20 Recombinant Protein, Bovine
Biozol Catalog Number: ASB-OPCA03052
Supplier Catalog Number: OPCA03052
Alternative Catalog Number: ASB-OPCA03052-100UG, ASB-OPCA03052-20UG
Manufacturer: Aviva
Host: Bovine
Category: Proteine/Peptide
Species Reactivity: Bovine
Alternative Names: C-C motif chemokine 20,chemokine (C-C motif) ligand 20,macrophage inflammatory protein 3 alpha,MIP-3-alpha,small-inducible cytokine A20.
Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.
Molecular Weight: 10.1 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 281666
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM