Nus1 Recombinant Protein, Mouse

Catalog Number: ASB-OPCA03063
Article Name: Nus1 Recombinant Protein, Mouse
Biozol Catalog Number: ASB-OPCA03063
Supplier Catalog Number: OPCA03063
Alternative Catalog Number: ASB-OPCA03063-100UG, ASB-OPCA03063-20UG
Manufacturer: Aviva
Host: Mouse
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: 1600027K07Rik,AU019165,AW538011,BC003223,D10Ertd438,D10Ertd438e,dehydrodolichyl diphosphate syntase complex subunit Nus1,dehydrodolichyl diphosphate synthase complex subunit Nus1,di-trans,poly-cis-decaprenylcistransferase,Ng,ngBR,Nogo-B receptor,nuclear undecaprenyl pyrophosphate synthase 1 homolog.
With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.
Molecular Weight: 13 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 52014
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD