Bag3 Recombinant Protein, Mouse

Catalog Number: ASB-OPCA03067
Article Name: Bag3 Recombinant Protein, Mouse
Biozol Catalog Number: ASB-OPCA03067
Supplier Catalog Number: OPCA03067
Alternative Catalog Number: ASB-OPCA03067-100UG, ASB-OPCA03067-20UG
Manufacturer: Aviva
Host: Mouse
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: AA407278,B,BAG family molecular chaperone regulator 3,BAG-3,bcl-2-associated athanogene 3,Bcl-2-binding protein Bis,Bcl-2-interacting death suppressor,Bis,mg638.
Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release. Nucleotide release is mediated via its binding to the nucleotide-binding domain (NBD) of HSPA8/HSC70 where as the substrate release is mediated via its binding to the substrate-binding domain (SBD) of HSPA8/HSC70. Has anti-apoptotic activity. Plays a role in the HSF1 nucleocytoplasmic transport.
Molecular Weight: 63.7 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 29810
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: Full Length of Mature Protein: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRP