PPAN Recombinant Protein, Human

Product Overview

• Article Name: PPAN Recombinant Protein, Human
• Biozol Catalog Number: ASB-OPCA03068
• Supplier Catalog Number: OPCA03068
• Alternative Catalog Number: ASB-OPCA03068-100UG, ASB-OPCA03068-20UG
• Manufacturer: Aviva
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: brix domain-containing protein 3,BXDC3,homolog of S. cerevisiae SSF1,P2RY11,P2Y purinoceptor 11,P2Y11,Peter Pan homolog,PPAN,PPAN-P2RY11 protein,PPAN-P2RY11 readthrough transcript,second-step splicing factor 1,SSF,SSF1,SSF-1,SSF1/P2Y11 protein,SSF2,suppressor of sterile four 1,suppressor of SWI4 1 homolog.

Product Description

May have a role in cell growth.

Product Properties

• Molecular Weight: 55.2 kDa
• Tag: N-terminal 6xHis-tagged
• NCBI: 692312, 56342
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQ