N141 Recombinant Protein

Catalog Number: ASB-OPCA03070
Article Name: N141 Recombinant Protein
Biozol Catalog Number: ASB-OPCA03070
Supplier Catalog Number: OPCA03070
Alternative Catalog Number: ASB-OPCA03070-100UG, ASB-OPCA03070-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Alternative Names: N141.
May be specifically involved in the formation of the nacreous layer.
Molecular Weight: 14.9 kDa
Tag: N-terminal 6xHis-tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN