RAVER2 Recombinant Protein, Human

Catalog Number: ASB-OPCA03072
Article Name: RAVER2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03072
Supplier Catalog Number: OPCA03072
Alternative Catalog Number: ASB-OPCA03072-100UG, ASB-OPCA03072-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: protein raver-2,ribonucleoprotein PTB-binding 2.
May bind single-stranded nucleic acids.
Molecular Weight: 17 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 55225
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT