SES1 Recombinant Protein, Yeast

Catalog Number: ASB-OPCA03182
Article Name: SES1 Recombinant Protein, Yeast
Biozol Catalog Number: ASB-OPCA03182
Supplier Catalog Number: OPCA03182
Alternative Catalog Number: ASB-OPCA03182-100UG,ASB-OPCA03182-1MG,ASB-OPCA03182-20UG
Manufacturer: Aviva
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Yeast
Alternative Names: serine--tRNA ligase SES1,Seryl-tRNA synthetase,Seryl-tRNA(Ser/Sec) synthetase,YDR023W.
Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
Molecular Weight: 57.3 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 851587
UniProt: P07284
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLDINQFIEDKGGNPELIRQSQKARNASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQKDIGLKFKNKEDASGLLAEKEKLTQQKKELTEKEQQEDKDLKKKVFQVGNIVHPSVVVSNDEENNELVRTWKPEDLEAVGPIASVTGKPASLSHHEILLRLDGYDPDRGVKICGHRGYFFRNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTAQLSEFDEELYKVIDGEDEKYLIATSEQPISAYH