At3g57050 Recombinant Protein, A. thaliana

Catalog Number: ASB-OPCA03196
Article Name: At3g57050 Recombinant Protein, A. thaliana
Biozol Catalog Number: ASB-OPCA03196
Supplier Catalog Number: OPCA03196
Alternative Catalog Number: ASB-OPCA03196-20UG,ASB-OPCA03196-100UG,ASB-OPCA03196-1MG
Manufacturer: Aviva
Host: A. thaliana
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Alternative Names: AT3G57050,Beta-cystathionase,cystathionine beta-lyase,Cysteine lyase.
Encodes second enzyme in the methionine biosynthetic pathway
Molecular Weight: 46.9 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 824872
UniProt: P53780
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NNTTDSLNTMNIKEEASVSTLLVNLDNKFDPFDAMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRG