SPRR3 Recombinant Protein, Human

Catalog Number: ASB-OPCA03201
Article Name: SPRR3 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03201
Supplier Catalog Number: OPCA03201
Alternative Catalog Number: ASB-OPCA03201-20UG,ASB-OPCA03201-100UG,ASB-OPCA03201-1MG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: 22 kDa pancornulin,cornifin beta,esophagin,small proline-rich protein 3.
Cross-linked envelope protein of keratinocytes.
Molecular Weight: 34 kda
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 6707
UniProt: Q9UBC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK