Ly96 Recombinant Protein, Mouse

Product Overview

• Article Name: Ly96 Recombinant Protein, Mouse
• Biozol Catalog Number: ASB-OPCA03206
• Supplier Catalog Number: OPCA03206
• Alternative Catalog Number: ASB-OPCA03206-20UG,ASB-OPCA03206-100UG,ASB-OPCA03206-1MG
• Manufacturer: Aviva
• Host: Mouse
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Alternative Names: ESO,ESOP-1,ly-96,lymphocyte antigen 96,MD2,MD-2,myeloid differentiation factor-2,myeloid differentiation protein-2,protein MD-2.

Product Description

Binds bacterial lipopolysaccharide (LPS) (PubMed:22532668). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS (PubMed:10725698).

Product Properties

• Molecular Weight: 32.4 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 17087
• UniProt: Q9JHF9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN