Keap1 Recombinant Protein, Mouse

Catalog Number: ASB-OPCA03207
Article Name: Keap1 Recombinant Protein, Mouse
Biozol Catalog Number: ASB-OPCA03207
Supplier Catalog Number: OPCA03207
Alternative Catalog Number: ASB-OPCA03207-20UG,ASB-OPCA03207-100UG,ASB-OPCA03207-1MG
Manufacturer: Aviva
Host: Mouse
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: cytosolic inhibitor of Nrf2,IN,INRF2,kelch-like ECH-associated protein 1,mKIAA0132,NRF2 cytosolic inhibitor,ring canal protein.
Acts as a substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1 and targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. Retains NFE2L2/NRF2 and may also retain BPTF in the cytosol. Targets PGAM5 for ubiquitination and degradation by the proteasome (By similarity).
Molecular Weight: 85.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 50868
UniProt: Q9Z2X8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHTKQAFGVMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLATLISRDDLNVRCESEVFHACIDWVKY