CYCB1-1 Recombinant Protein, A. thaliana

Catalog Number: ASB-OPCA03213
Article Name: CYCB1-1 Recombinant Protein, A. thaliana
Biozol Catalog Number: ASB-OPCA03213
Supplier Catalog Number: OPCA03213
Alternative Catalog Number: ASB-OPCA03213-20UG,ASB-OPCA03213-100UG,ASB-OPCA03213-1MG
Manufacturer: Aviva
Host: A. thaliana
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Alternative Names: AT4G37490,CYC1,Cyc1-At,CYCB1,CYCLIN 1,CYCLIN B1,1,F6G17.140,F6G17_140,G2/mitotic-specific cyclin-B1-1.
Cyclin-dependent protein kinase CYCB1,1. Functions as an effector of growth control at G2/M. Regulated by TCP20.
Molecular Weight: 52.5 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 829904
UniProt: P30183
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMTSRSIVPQQSTDDVVVVDGKNVAKGRNRQVLGDIGNVVRGNYPKNNEPEKINHRPRTRSQNPTLLVEDNLKKPVVKRNAVPKPKKVAGKPKVVDVIEISSDSDEELGLVAAREKKATKKKATTYTSVLTARSKAACGLEKKQKEKIVDIDSADVENDLAAVEYVEDIYSFYKSVESEWRPRDYMASQPDINEKMRLILVEWLIDVHVRFELNPETFYLTVNILDRFLSVKPVPRKELQLVGLSALLMSAKYEE