IFNAG Recombinant Protein, E. coli

Product Overview

• Article Name: IFNAG Recombinant Protein, E. coli
• Biozol Catalog Number: ASB-OPCA03215
• Supplier Catalog Number: OPCA03215
• Alternative Catalog Number: ASB-OPCA03215-20UG,ASB-OPCA03215-100UG,ASB-OPCA03215-1MG
• Manufacturer: Aviva
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bovine
• Alternative Names: IF1AG6,IFN-alpha7,interferon 1AG6,interferon alpha-G.

Product Description

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Product Properties

• Molecular Weight: 35.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 100329206
• UniProt: P49877
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD