CD8A Recombinant Protein, Human

Catalog Number: ASB-OPCA03223
Article Name: CD8A Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03223
Supplier Catalog Number: OPCA03223
Alternative Catalog Number: ASB-OPCA03223-20UG,ASB-OPCA03223-100UG,ASB-OPCA03223-1MG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CD8,CD8 antigen, alpha polypeptide (p32),Leu2,Leu2 T-lymphocyte antigen,OKT8 T-cell antigen,p32,T cell co-receptor,T8 T-cell antigen,T-cell antigen Leu2,T-cell surface glycoprotein CD8 alpha chain,T-lymphocyte differentiation antigen T8/Leu-2.
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.
Molecular Weight: 33.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 925
UniProt: P01732
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD