tgfb1 Recombinant Protein, Xenopus

Catalog Number: ASB-OPCA03225
Article Name: tgfb1 Recombinant Protein, Xenopus
Biozol Catalog Number: ASB-OPCA03225
Supplier Catalog Number: OPCA03225
Alternative Catalog Number: ASB-OPCA03225-20UG,ASB-OPCA03225-100UG,ASB-OPCA03225-1MG
Manufacturer: Aviva
Host: Xenopus
Category: Proteine/Peptide
Species Reactivity: Xenopus
Alternative Names: ced,dpd1,lap,tgf beta,tgfb,tgfb1,tgfb5,tgfbeta,tgf-beta,tgf-beta 5,TGF-beta-1,TGF-beta5,TGF-beta-5,transforming gorwth factor-Beta5,transforming growth factor beta-1 proprotein,transforming growth factor-B5,transforming growth factor-beta 5 (TGF-beta 5),XELAEV_18039344mg.
Important role in certain aspects of differentiation.
Molecular Weight: 28.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 397778
UniProt: P16176
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS