GLO1 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04783
Article Name: GLO1 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04783
Supplier Catalog Number: OPCA04783
Alternative Catalog Number: ASB-OPCA04783-100UG, ASB-OPCA04783-1MG, ASB-OPCA04783-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: aldoketomutase,epididymis secretory protein Li 74,GLOD1,glx I,GLYI,glyoxalase domain containing 1,Glyoxalase I,HEL-S-74,ketone-aldehyde mutase,lactoyl glutathione lyase,lactoylglutathione lyase,methylglyoxalase,S-D-lactoylglutathione methylglyoxal lyase.
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.
Molecular Weight: 47.8 kDa
Tag: N-terminal GST-tagged
NCBI: 2739
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM