GSTA2 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04784
Article Name: GSTA2 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04784
Supplier Catalog Number: OPCA04784
Alternative Catalog Number: ASB-OPCA04784-100UG, ASB-OPCA04784-1MG, ASB-OPCA04784-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: glutathione S-alkyltransferase A2,glutathione S-aralkyltransferase A2,glutathione S-aryltransferase A2,glutathione S-transferase A2,GST class-alpha member 2,GST HA subunit 2,GST2,GSTA2-2,GST-gamma,GTA2,GTH2,liver GST2,S-(hydroxyalkyl)glutathione lyase A2,testis tissue sperm-binding protein Li 59n.
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Molecular Weight: 52.7 kDa
Tag: N-terminal GST-tagged
NCBI: 2939
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF